DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-5

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_492616.1 Gene:nas-5 / 188819 WormBaseID:WBGene00003524 Length:360 Species:Caenorhabditis elegans


Alignment Length:231 Identity:66/231 - (28%)
Similarity:112/231 - (48%) Gaps:27/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IKAHPIRTRNGIV------NQIYHWP-------NRTVPYMIEDDAFADSHYREILR-AISIIEEN 85
            :.:.|||.|..|.      |....|.       |..:||:|..:  .|:..|:.:: |:..|..|
 Worm    47 VYSSPIRERRPIFRNALLSNSPLRWSKMQDLDGNYLIPYVISGN--YDTVERDTIKTAMEKIANN 109

  Fly    86 SCVIFKPAT-EMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHV 149
            :|:...|.| :.|:  |.:...||.|| ...:|......||.||... .:.|.:..::||||.||
 Worm   110 TCIRLIPRTNQPDY--AEINNKKGQGC-YASIGRFPGKNVVMLESND-DQSCIQEDTVIHELFHV 170

  Fly   150 LGFEHQHVSQNRDQYVSIQWKNINP-QY-NINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRN 212
            :|..|:|:..:||.::::.:|||.| || ....:::.::|.   :...|||.|||||...||::.
 Worm   171 IGLWHEHMRADRDAFINVLYKNIEPAQYPQFEKLSSRDATT---YSVPYDYNSVMHYDENAFAKP 232

  Fly   213 GQPTIVPLREGAEN-MGQRFYMSEKDIRKLNKMYRC 247
            |:.:::......:. :|.....|..|.:|:..:|.|
 Worm   233 GKISMMTKDSKFQKVIGHPKDASSNDYKKVCAIYHC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 60/207 (29%)
ZnMc_astacin_like 55..245 CDD:239807 57/194 (29%)
nas-5NP_492616.1 ZnMc_astacin_like 80..266 CDD:239807 57/194 (29%)
Astacin 83..269 CDD:279708 58/195 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5777
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.