DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-27

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_493926.2 Gene:nas-27 / 188809 WormBaseID:WBGene00003545 Length:428 Species:Caenorhabditis elegans


Alignment Length:261 Identity:68/261 - (26%)
Similarity:108/261 - (41%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIFLFTPTVFSELFKDP--------------ELLAG----FYQGDIKAHPIRTRNGIVNQIYHWP 54
            ::.:|.|.:.:.|...|              ..|.|    .|||||.....|.|..::.|.:...
 Worm     3 ILPIFFPLLITSLHAIPRGRRAVRNRNEGDINSLVGVGQYLYQGDIAVVKSRARRAVIRQKHKKW 67

  Fly    55 NRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYR 119
            ...:||.. |..|.....:.:|.|:....|.:||.|.   |..:....|...:|.||    ..:.
 Worm    68 KLPMPYSF-DRNFPSRSRQRVLEAMQFWSEKTCVTFH---ENRYVYPHVSIFEGNGC----WSFV 124

  Fly   120 NKTQVVNLEIYPLGEGCFRIGSII-HELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNN 183
            .|...:..:...|...|.....:: ||:.|.|||.|:|...:|||::||.:.|:||.....|...
 Worm   125 GKQPSLREQSLSLERSCTDHTFVVAHEIAHTLGFYHEHARGDRDQFISIDYSNVNPNLTFAFAKE 189

  Fly   184 DNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPLREG--AENMGQRFYMSEKDIRKLNKMYR 246
            ......|. :..|:|.|||||....|:.|....::..|:.  |:.||.|...:.:|:.::|.:|.
 Worm   190 SEKQLDHQ-EAAYEYGSVMHYSVDQFAVNTNRPVIYARDQKFAQAMGNRMRATFQDVSRMNVLYN 253

  Fly   247 C 247
            |
 Worm   254 C 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 54/198 (27%)
ZnMc_astacin_like 55..245 CDD:239807 52/192 (27%)
nas-27NP_493926.2 Astacin 65..254 CDD:279708 53/197 (27%)
ZnMc_astacin_like 70..252 CDD:239807 52/190 (27%)
CUB 334..410 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.