DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-20

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505906.2 Gene:nas-20 / 188420 WormBaseID:WBGene00003539 Length:379 Species:Caenorhabditis elegans


Alignment Length:251 Identity:58/251 - (23%)
Similarity:94/251 - (37%) Gaps:64/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIFLFTPTVFSELFKDPELLAGFYQGDIKAHPIRTRNGIVNQIYHWPNRTVPYM-----IEDDAF 67
            |..:..|:|.|:                 .|..|.:...:.....|.|..:...     :|..|.
 Worm    10 VALIGVPSVLSD-----------------RHITRDKRQAMRDYAKWENNKMSLFFYNLPLEMQAM 57

  Fly    68 ADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPL 132
                :|:   ||:.:|.::|:.|:.....:   ..|...||.||.:::..:..:.|.:.|:.   
 Worm    58 ----FRD---AINYLENHTCLKFEYNENAE---TAVRIRKGNGCYSLYGMHAGEVQDLTLDY--- 109

  Fly   133 GEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYD 197
              .|...|:.:||::|.||..|.....:||.|:.:...|.|.    ...|.:|...       :|
 Worm   110 --NCASFGTAVHEIMHALGIAHGQARSDRDDYLIVDSTNSND----GIENTENLVP-------FD 161

  Fly   198 YESVMHYV--PRAFSRNGQPTIVPL-REGAENMGQ---RFYMSEKDIRKLNKMYRC 247
            |.|||.|.  |.:..|      :|: .|....||.   .||    |:..|||.|.|
 Worm   162 YGSVMLYARDPHSDKR------IPIDPEYNFTMGSLRVAFY----DMVLLNKFYGC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 52/206 (25%)
ZnMc_astacin_like 55..245 CDD:239807 49/200 (25%)
nas-20NP_505906.2 Astacin 36..209 CDD:279708 52/208 (25%)
ZnMc 49..205 CDD:294052 48/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.