DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-19

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505893.2 Gene:nas-19 / 186926 WormBaseID:WBGene00003538 Length:396 Species:Caenorhabditis elegans


Alignment Length:209 Identity:53/209 - (25%)
Similarity:88/209 - (42%) Gaps:37/209 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGL 109
            |:||..|...|..:..|:|.             ||:.|..::|:.|.........:.:.:....|
 Worm    53 GVVNYYYADKNNEIKEMVES-------------AIAYIANHTCIRFNEDQNAVQRVQIRMQQNWL 104

  Fly   110 GCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQW--KNI 172
            ..:||.....:.::.:. |:..|.:.|..||||:||..|.||..|:|...:||.::.:..  ...
 Worm   105 CQSTVGAPGMSMSKPIG-ELSMLVQSCDTIGSIVHEFSHSLGRFHEHTRPDRDNFMKVTTTVHEA 168

  Fly   173 NPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPL-REGAENMGQR---FYM 233
            .|:      .:..:|.:..|:.|    |||.|....:   |..|:.|| .:..:.||.|   || 
 Worm   169 RPR------PSGMTTMYGPFEHG----SVMMYHADTY---GPGTMDPLDMDYKQTMGNRRVTFY- 219

  Fly   234 SEKDIRKLNKMYRC 247
               |:.|:|:.|.|
 Worm   220 ---DMYKINQYYGC 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 49/201 (24%)
ZnMc_astacin_like 55..245 CDD:239807 47/195 (24%)
nas-19NP_505893.2 Astacin 48..230 CDD:279708 52/207 (25%)
ZnMc 53..228 CDD:294052 51/205 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.