Sequence 1: | NP_609756.1 | Gene: | Semp1 / 34914 | FlyBaseID: | FBgn0028944 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001023994.1 | Gene: | nas-31 / 186493 | WormBaseID: | WBGene00003549 | Length: | 611 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 60/207 - (28%) |
---|---|---|---|
Similarity: | 102/207 - (49%) | Gaps: | 29/207 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 NQIYHWPNRT-VPYMIEDDAFADSHYREILRAISIIEENSCV-IFKPATEMDFPMALVITSKGLG 110
Fly 111 CNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQ 175
Fly 176 YNINFVNNDNSTAWHDFDEG--YDYESVMHYVPRAFSRNGQPTIVPL-REGAENMGQRFYMSEKD 237
Fly 238 IRKLNKMYRCPD 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Semp1 | NP_609756.1 | Astacin | 53..249 | CDD:279708 | 59/200 (30%) |
ZnMc_astacin_like | 55..245 | CDD:239807 | 57/194 (29%) | ||
nas-31 | NP_001023994.1 | Astacin | 169..355 | CDD:279708 | 60/205 (29%) |
ZnMc_astacin_like | 175..351 | CDD:239807 | 58/199 (29%) | ||
ShKT | 532..564 | CDD:214586 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |