DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-31

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001023994.1 Gene:nas-31 / 186493 WormBaseID:WBGene00003549 Length:611 Species:Caenorhabditis elegans


Alignment Length:207 Identity:60/207 - (28%)
Similarity:102/207 - (49%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NQIYHWPNRT-VPYMIEDDAFADSHYREILRAISIIEENSCV-IFKPATEMDFPMALVITSKGLG 110
            :.:|::.:|| .|.:::  ||.        :|::..:..:|: |.:.:|.::    .:...||.|
 Worm   173 SSVYYYYDRTATPKIVK--AFE--------QAVAFWQNVTCINIMQSSTAIN----RIRVFKGQG 223

  Fly   111 CNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQ 175
            |      |....::..::...||.||...|:..|||.|.|||.|.....:||.|:||.:.||:|.
 Worm   224 C------YSYVGRISGVQDLSLGTGCEEFGTAAHELGHALGFFHTQSRYDRDNYISINYANIDPS 282

  Fly   176 YNINFVNNDNSTAWHDFDEG--YDYESVMHYVPRAFSRNGQPTIVPL-REGAENMGQRFYMSEKD 237
            |...|   |..|:..:|:.|  |||.|:|.|...:.|.|.:.|::.. .|..:.||..| :...|
 Worm   283 YVEQF---DKETSNTNFNYGMPYDYGSIMQYGATSASSNDKATMIARDTEYQDTMGSDF-VGFYD 343

  Fly   238 IRKLNKMYRCPD 249
            |..:|:.|:|.:
 Worm   344 ISMMNEHYKCKE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 59/200 (30%)
ZnMc_astacin_like 55..245 CDD:239807 57/194 (29%)
nas-31NP_001023994.1 Astacin 169..355 CDD:279708 60/205 (29%)
ZnMc_astacin_like 175..351 CDD:239807 58/199 (29%)
ShKT 532..564 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.