DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-28

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_498342.3 Gene:nas-28 / 185658 WormBaseID:WBGene00003546 Length:497 Species:Caenorhabditis elegans


Alignment Length:210 Identity:66/210 - (31%)
Similarity:102/210 - (48%) Gaps:16/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RNGIVNQIYHWPNRTVPYMIE-DDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITS 106
            |..||:....| :.:||...: |...:.::...:.:||....:|||:.||  .:.:....|.::|
 Worm   120 RQAIVDTTNFW-SVSVPIFYQFDTKLSATNIANVRKAIQFWNDNSCLSFK--EDNNAKNRLFLSS 181

  Fly   107 KGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKN 171
            .| ||    ..|..|...:..::..:|..|...|:..|||:|.:||.||....:||.||.:.:.|
 Worm   182 AG-GC----WSYVGKQVDMPYQMVSVGPNCDTFGTATHELMHAIGFWHQQSRADRDNYVYVDFSN 241

  Fly   172 INPQ--YNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFS-RNGQPTIVPLREGAEN-MGQRFY 232
            |.|.  ||...:..|.:..   .:..|||.|||.|.|.||: .:.:.||:....|.:| ||||..
 Worm   242 IIPSQAYNFQKMAVDQAQL---LNLPYDYGSVMQYYPYAFAVDSSKYTILAKENGFQNSMGQREA 303

  Fly   233 MSEKDIRKLNKMYRC 247
            .:..||..:||:|.|
 Worm   304 PAFSDIIGVNKLYNC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 63/200 (32%)
ZnMc_astacin_like 55..245 CDD:239807 60/194 (31%)
nas-28NP_498342.3 Astacin 135..320 CDD:279708 61/194 (31%)
ZnMc_astacin_like 135..316 CDD:239807 59/190 (31%)
CUB 393..480 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.