DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-13

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_510549.3 Gene:nas-13 / 185492 WormBaseID:WBGene00003532 Length:450 Species:Caenorhabditis elegans


Alignment Length:244 Identity:79/244 - (32%)
Similarity:119/244 - (48%) Gaps:44/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YQGDIKAHPIRTRN-----------GI-------VNQIY-HWPNRTVPYMIEDDAFADSHYREIL 76
            ::|||....:.:|:           ||       |.|.| .|....:||.|... ::.....:|.
 Worm    78 FEGDIANSGLNSRSINTFFGDSPLFGIFGVQRNAVRQTYLKWEQARIPYTISSQ-YSSYSRSKIA 141

  Fly    77 RAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGS 141
            .||....:.:|:.|.|.:..|.....::...  ||.:: :|.....|.|:     ||:||.:.|.
 Worm   142 EAIEEYRKKTCIDFSPKSAGDLDYIHIVPDD--GCYSL-VGRIGGKQPVS-----LGDGCIQKGI 198

  Fly   142 IIHELLHVLGFEHQHVSQNRDQYVSIQWKNIN-------PQYNINFVNNDNSTAWHDFDEGYDYE 199
            |||||:|.:||.|:....:||:||.|.|.|:.       .:|::|.:::        ....|||.
 Worm   199 IIHELMHAVGFFHEQSRADRDEYVKINWSNVEAGLQDQFDKYSLNMIDH--------LGTKYDYG 255

  Fly   200 SVMHYVPRAFSRNGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRCP 248
            |||||.|.|||:||:|||.|:.:..| :|||...||.||.|:|.:|.||
 Worm   256 SVMHYAPTAFSKNGKPTIEPIEKNVE-IGQRAGFSENDIYKINMLYNCP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 70/203 (34%)
ZnMc_astacin_like 55..245 CDD:239807 66/196 (34%)
nas-13NP_510549.3 Astacin 118..304 CDD:279708 70/204 (34%)
ZnMc_astacin_like 122..300 CDD:239807 66/195 (34%)
ShK 367..404 CDD:279838
ShK 414..450 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.