Sequence 1: | NP_609756.1 | Gene: | Semp1 / 34914 | FlyBaseID: | FBgn0028944 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506409.2 | Gene: | nas-24 / 184744 | WormBaseID: | WBGene00003543 | Length: | 396 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 53/207 - (25%) |
---|---|---|---|
Similarity: | 83/207 - (40%) | Gaps: | 39/207 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 WPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGC-NTVHL 116
Fly 117 -GYRNKTQVVNLEIYPLGE------GCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINP 174
Fly 175 QYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPL-REGAENMGQR---FYMSE 235
Fly 236 KDIRKLNKMYRC 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Semp1 | NP_609756.1 | Astacin | 53..249 | CDD:279708 | 53/207 (26%) |
ZnMc_astacin_like | 55..245 | CDD:239807 | 50/201 (25%) | ||
nas-24 | NP_506409.2 | Astacin | 49..231 | CDD:279708 | 53/207 (26%) |
ZnMc | 52..227 | CDD:294052 | 50/201 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D681837at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |