DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-24

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_506409.2 Gene:nas-24 / 184744 WormBaseID:WBGene00003543 Length:396 Species:Caenorhabditis elegans


Alignment Length:207 Identity:53/207 - (25%)
Similarity:83/207 - (40%) Gaps:39/207 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 WPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGC-NTVHL 116
            |...|:.|...|:  .:|...::..||:.|..::|:.|. .....:....:.||:...| :|:..
 Worm    50 WLGGTINYYYADN--NNSVKEKVKSAIAYIANHTCIKFN-EDPTHWQRLKIFTSELSHCRSTIGA 111

  Fly   117 -GYRNKTQVVNLEIYPLGE------GCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINP 174
             |.|:.:         .||      .|..||||:||..|.||..|:|...:||..:.:    .:.
 Worm   112 PGTRSGS---------AGELSMETGWCANIGSIVHEFSHSLGRYHEHTRPDRDNSLKV----TST 163

  Fly   175 QYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPL-REGAENMGQR---FYMSE 235
            .|.........:|.:..|:.|    |:|.|   ..|..|...:.|. .|....||.|   ||   
 Worm   164 DYEARPRPWGMTTMYGPFEHG----SIMMY---HSSNYGVGKMEPYDMEYKNTMGSRRVTFY--- 218

  Fly   236 KDIRKLNKMYRC 247
             |:.|:|:.|.|
 Worm   219 -DMYKINQYYGC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 53/207 (26%)
ZnMc_astacin_like 55..245 CDD:239807 50/201 (25%)
nas-24NP_506409.2 Astacin 49..231 CDD:279708 53/207 (26%)
ZnMc 52..227 CDD:294052 50/201 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.