DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-14

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_502533.2 Gene:nas-14 / 184247 WormBaseID:WBGene00003533 Length:503 Species:Caenorhabditis elegans


Alignment Length:247 Identity:83/247 - (33%)
Similarity:123/247 - (49%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YQGDIKAHPIRTRNGIVNQI---------------YH------------WPNRTVPYMIEDDAFA 68
            ::|||...|...::.|:.::               :|            ||...||||:|:....
 Worm    76 FEGDIMGVPEIEKSDILKRLRDDPLLDEDEIFRKPFHSALNLVTYPDKLWPEGQVPYMLEEGMTN 140

  Fly    69 DSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLG 133
            |.. ..|.:|....:..:||.|.|.|:.||....|..:...||:: ::|.....|.|:||:    
 Worm   141 DQR-TAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAFGCSS-YVGRAGGNQTVSLEV---- 199

  Fly   134 EGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDY 198
            :.||..|.|.|||:|.|||.|:|...:||.:|.|...||.|....||........ ......|||
 Worm   200 DKCFSKGIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRPGMMRNFEKYPRKII-DSLGMPYDY 263

  Fly   199 ESVMHYVPRAFSRNGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRCPDH 250
            ||||||...||||||:|||:| ::...::|||:.:||.|.:|:||:|:|.::
 Worm   264 ESVMHYHKLAFSRNGKPTIIP-KDNEADVGQRYKLSEMDSKKVNKLYQCGEY 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 77/195 (39%)
ZnMc_astacin_like 55..245 CDD:239807 73/189 (39%)
nas-14NP_502533.2 Astacin 123..313 CDD:279708 77/197 (39%)
ZnMc_astacin_like 128..309 CDD:239807 73/188 (39%)
ShKT 380..414 CDD:214586
ShK 468..503 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.