DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-8

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_501114.2 Gene:nas-8 / 183207 WormBaseID:WBGene00003527 Length:403 Species:Caenorhabditis elegans


Alignment Length:254 Identity:77/254 - (30%)
Similarity:124/254 - (48%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FKDPELL------AG-------FYQGDIK-----------AHPIRTRNGIVNQIYHWPNRTVPYM 61
            ||:.|.|      ||       :.:|||:           :..:| |||::.....|||..:||:
 Worm    66 FKNGEKLGEDHVPAGSILWKQVYKKGDIRGKAAWKLDPKNSESLR-RNGVITGTRKWPNGRIPYV 129

  Fly    62 IEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVN 126
            |.:. :.|.....:.|:.....:.:||.|.|.|.:|.....:  .|..||.: .:|.....|.::
 Worm   130 ISNQ-YNDRERAVLARSFQAYHDKTCVRFVPRTAVDNDYLYI--GKIDGCYS-DVGRAGGRQELS 190

  Fly   127 LEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHD 191
            |:     .||.:..:.||||:|.:||.|:|...:||::::|.|.||:.:....|...|.:.:.: 
 Worm   191 LD-----NGCLQYDTAIHELMHSVGFYHEHERWDRDEHITILWHNIDREAYDQFGKVDLAESSY- 249

  Fly   192 FDEGYDYESVMHYVPRAFSRNGQPTIVPLR-EGAENMGQRFYMSEKDIRKLNKMYRCPD 249
            :.:.|||.|:|||...|||:||..|:|..: |....:|.....|..||.|:|.||:|.|
 Worm   250 YGQLYDYYSIMHYDSLAFSKNGFETMVAKQSEMTAVIGAAIDFSPIDILKMNLMYQCSD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 63/196 (32%)
ZnMc_astacin_like 55..245 CDD:239807 58/190 (31%)
nas-8NP_501114.2 Astacin 119..308 CDD:279708 63/198 (32%)
ZnMc_astacin_like 123..304 CDD:239807 58/190 (31%)
ShK 337..372 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.