DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-4

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001254938.1 Gene:nas-4 / 182259 WormBaseID:WBGene00003523 Length:365 Species:Caenorhabditis elegans


Alignment Length:248 Identity:82/248 - (33%)
Similarity:129/248 - (52%) Gaps:42/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KDPELLAGFYQGDIKAHPIRT---------RNGIVNQIY-HWPNRTVPYMIEDDAFADSHYREIL 76
            ||...:..:.:|||.....:.         ||.| .||| .|||..:||.:...  ..|:.|.::
 Worm    64 KDDPTIGNYSEGDILLESPKKFVEENNKLGRNAI-KQIYRRWPNNEIPYTLSSQ--YGSYARSVI 125

  Fly    77 -RAISIIEENSCVIF---KPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCF 137
             .|::.....:||.|   .|:...|:    :......||.:: :|.....|.|:|:     .||.
 Worm   126 ANAMNEYHTKTCVKFVARDPSKHHDY----LWIHPDEGCYSL-VGKTGGKQPVSLD-----SGCI 180

  Fly   138 RIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNIN-------PQYNINFVNNDNSTAWHDFDEG 195
            ::|:|:|||:|.:||.|:...|:||.|:.:.|:|:.       .:||:|.:::        .||.
 Worm   181 QVGTIVHELMHAVGFFHEQSRQDRDSYIDVVWQNVMNGADDQFEKYNLNVISH--------LDEP 237

  Fly   196 YDYESVMHYVPRAFSRNGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRCP 248
            |||.|:|||.|.|||.:|:.|:||.:.|:|.||||...|:.|:||:||:|.||
 Worm   238 YDYASIMHYGPYAFSGSGKKTLVPKKSGSERMGQRVKFSDIDVRKINKLYNCP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 71/207 (34%)
ZnMc_astacin_like 55..245 CDD:239807 66/200 (33%)
nas-4NP_001254938.1 Astacin 102..290 CDD:279708 69/207 (33%)
ZnMc_astacin_like 106..287 CDD:239807 66/200 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5777
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.