DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-6

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001040902.1 Gene:nas-6 / 181796 WormBaseID:WBGene00003525 Length:344 Species:Caenorhabditis elegans


Alignment Length:233 Identity:76/233 - (32%)
Similarity:115/233 - (49%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AGFYQGDIKA----------HPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISII 82
            :|.:||||..          .|: ..|.:.|:...|....:||.: |.||:.:..:.:.:|....
 Worm    47 SGKFQGDIDGVDPNLLKLPEGPV-LFNALKNKQLTWEGGVIPYEM-DTAFSPNEIKILEKAFDSY 109

  Fly    83 EENSCVIF-KPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHEL 146
            ...:|:.| |...:.|: :.:|   ||.||.: .:|.....|.::     ||.|||....|:|||
 Worm   110 RRTTCIRFEKREGQTDY-LNIV---KGYGCYS-QVGRTGGKQEIS-----LGRGCFFHEIIVHEL 164

  Fly   147 LHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFD-EGYDYESVMHYVPRAFS 210
            :|.:||.|:|...:||.::.|.|.||.|.....|  :..|....|.. |.|||:|:|||...|||
 Worm   165 MHSVGFWHEHSRADRDDHIKINWDNILPGMKSQF--DKISAVLQDLQGENYDYKSIMHYDSTAFS 227

  Fly   211 RNGQPTIVPLREG-AENMGQRFYMSEKDIRKLNKMYRC 247
            |||:.||..:..| .:.:|....:|..||.|:||:|.|
 Worm   228 RNGRNTIETVENGFTQVIGTAMDLSPLDIVKINKLYSC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 68/198 (34%)
ZnMc_astacin_like 55..245 CDD:239807 65/192 (34%)
nas-6NP_001040902.1 Astacin 80..265 CDD:279708 67/197 (34%)
ZnMc_astacin_like 83..263 CDD:239807 65/192 (34%)
ShK 299..334 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5777
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.