DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and hch-1

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_510440.1 Gene:hch-1 / 181564 WormBaseID:WBGene00001828 Length:605 Species:Caenorhabditis elegans


Alignment Length:213 Identity:63/213 - (29%)
Similarity:102/213 - (47%) Gaps:24/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIF---KPATEMDFPMAL 102
            |:....:::.:.:|   |||.|:..:..:::  .:|..::..|:.:|..|   ...:......||
 Worm   124 RSMTSFLSERWSFP---VPYYIDTSSGVNTN--AVLAGVAKWEQETCARFTRLNSYSSSSRQNAL 183

  Fly   103 VITSKGLGCNTVHLGYRNKTQVVNLEIYP----LGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQ 163
            ...| |.||      |.|   :..:..:|    :|.||..:|::.||:.|.|||.|:....:||.
 Worm   184 RFIS-GNGC------YSN---IGKVSRFPQDVSIGWGCTSLGTVCHEIGHALGFYHEQARYDRDD 238

  Fly   164 YVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPLREGAE-NM 227
            ||||..:||...|...| ...::::..|:..||||.|||||...|||..|..||.......: .:
 Worm   239 YVSILTQNIQDMYLSQF-TKQSASSMVDYGVGYDYGSVMHYDQAAFSSTGGNTIATRDPNFQATI 302

  Fly   228 GQRFYMSEKDIRKLNKMY 245
            |||...|..|::::|..|
 Worm   303 GQRVAPSFADVKRINFAY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 62/201 (31%)
ZnMc_astacin_like 55..245 CDD:239807 60/197 (30%)
hch-1NP_510440.1 Astacin 132..323 CDD:279708 62/205 (30%)
ZnMc_astacin_like 135..320 CDD:239807 61/200 (31%)
CUB 386..466 CDD:214483
TSP1 533..565 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.