DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-10

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001257126.1 Gene:nas-10 / 181287 WormBaseID:WBGene00003529 Length:540 Species:Caenorhabditis elegans


Alignment Length:217 Identity:68/217 - (31%)
Similarity:103/217 - (47%) Gaps:25/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NQIYHWPNRT-VPYMIEDDAFADSHYREILRAISIIEENSCVIFK------PATEMDFPMALVIT 105
            |.|..||:.: :||.. |.:..:....::..|||.||:.:|:.||      ....:::..   :.
 Worm   300 NLIQKWPSTSPIPYTF-DSSLDNLDQNDVRGAISEIEQKTCIRFKYFASPPKGNHINYQK---VN 360

  Fly   106 SKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWK 170
            |... |...::|.......|.|. :..|.|   .|..:||.:|.||..|||:..:||:::.:.|.
 Worm   361 SPSF-CGLSYIGRVEPANPVYLS-FQCGNG---RGIAVHETMHALGVNHQHLRMDRDKHIKVDWS 420

  Fly   171 NINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRN-GQPTIVPLREGAEN---MGQRF 231
            |||||....||..| |..:..:...|.|:|:|||.....:.| .:||::||.....|   :|||.
 Worm   421 NINPQQYDAFVVAD-SKLYTTYGVKYAYDSIMHYNAYTGAVNIAKPTMIPLVNQQANIGLLGQRA 484

  Fly   232 YMSEKDIRKLNKMY----RCPD 249
            .||..|:..|||||    .|.|
 Worm   485 KMSNADVEILNKMYCKSAGCDD 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 65/210 (31%)
ZnMc_astacin_like 55..245 CDD:239807 60/200 (30%)
nas-10NP_001257126.1 Astacin 303..501 CDD:396122 64/207 (31%)
ShK 503..540 CDD:396228 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.