DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-37

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001024413.1 Gene:nas-37 / 181208 WormBaseID:WBGene00003553 Length:765 Species:Caenorhabditis elegans


Alignment Length:218 Identity:63/218 - (28%)
Similarity:97/218 - (44%) Gaps:34/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILR-AISIIEENSCVIFKPATEMDFP 99
            :||| ..||       .|||.|:.|....   .:..:|:::| ||..:|:|.|..||   |....
 Worm   115 QAHP-DPRN-------FWPNLTISYEFYG---GEETWRQLIRSAIRHVEQNVCFKFK---ENGGD 165

  Fly   100 MALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQY 164
            ...:...:|.||      :.|..:|...::..:|.||..:|.:.||.||.||..|:....:||.:
 Worm   166 RDGLRYYRGNGC------WSNVGRVGGRQLVSIGYGCDSLGIVSHETLHALGLWHEQSRDDRDNF 224

  Fly   165 VSIQWKNINPQYNINF-----VNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPLREG- 223
            :||....|......||     .|:||      ..:.||..|||||..::|:.:.....:..|:. 
 Worm   225 ISIVADKITRGTEGNFAKRTAANSDN------LGQPYDLGSVMHYGAKSFAYDWSSDTIKTRDWR 283

  Fly   224 -AENMGQRFYMSEKDIRKLNKMY 245
             ...:|||..:|.||.:.:|..|
 Worm   284 YQNTIGQRDGLSFKDAKMINTRY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 58/201 (29%)
ZnMc_astacin_like 55..245 CDD:239807 55/197 (28%)
nas-37NP_001024413.1 Astacin 122..309 CDD:279708 59/210 (28%)
ZnMc_astacin_like 126..306 CDD:239807 55/197 (28%)
CUB 370..455 CDD:214483
TSP1 579..626 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.