DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-11

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001024789.1 Gene:nas-11 / 180938 WormBaseID:WBGene00003530 Length:579 Species:Caenorhabditis elegans


Alignment Length:217 Identity:71/217 - (32%)
Similarity:102/217 - (47%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NQIYHW-PNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGC 111
            |.|..| |:..:.|:: |.:..|....::..||..||:|:|:.||.           ::|...|.
 Worm   336 NLIKKWDPSSPIRYVL-DSSLEDLDKNDVRAAIYEIEKNTCIRFKE-----------LSSPPTGS 388

  Fly   112 NTVH----------LGYRNKTQVVNLEIYPLGEGC-FRIGSIIHELLHVLGFEHQHVSQNRDQYV 165
            :.|:          |.|..:....| .:| |..|| ...|..|||.:|.||..|||:..:|||::
 Worm   389 HIVYYKVDSPTFCGLSYVGRADPAN-PVY-LSFGCDNNKGVAIHETMHALGVAHQHLRNDRDQFI 451

  Fly   166 SIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRN-GQPTIVPLREGAEN--- 226
            :|.|.||:||....||..| |..:..:...|.|:|:|||.....::| ..||:.|....|.|   
 Worm   452 TINWSNIDPQQYDAFVVVD-SKLYTSYGVKYAYDSIMHYNGYTAAQNIAIPTMNPKTNSAVNLKV 515

  Fly   227 MGQRFYMSEKDIRKLNKMYRCP 248
            :|||..|...||..|.|||..|
 Worm   516 LGQRQKMGTTDIELLKKMYCQP 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 69/212 (33%)
ZnMc_astacin_like 55..245 CDD:239807 64/204 (31%)
nas-11NP_001024789.1 Astacin 339..537 CDD:279708 68/212 (32%)
ZnMc_astacin_like 346..534 CDD:239807 64/202 (32%)
ShK 538..575 CDD:279838 71/217 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.