DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-38

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001359993.1 Gene:nas-38 / 180407 WormBaseID:WBGene00003554 Length:727 Species:Caenorhabditis elegans


Alignment Length:280 Identity:63/280 - (22%)
Similarity:118/280 - (42%) Gaps:71/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TVFSELFKDP-------ELLAG----FYQGDIKAHPIRTRNGIV----------------NQIY- 51
            |||.::.::|       ||...    ::|||:.....:.:  |:                |.:| 
 Worm    60 TVFDDIQRNPNTGVHHDELAVNNADEYFQGDVDLSEQQVK--IIEDQFTQGKREKRKIGRNPLYK 122

  Fly    52 HWPNR---------TVPYMIEDDAFADSHYREILRAISIIEENSCVIFKP----ATEMDFPMALV 103
            .|..|         ::|:...         ::|..|:.:.::::|:.|:.    ...::|     
 Worm   123 KWDTRGPISFDYAESIPFQTR---------QKIRSAMLLWQQHTCLRFEEGGPNVDRLEF----- 173

  Fly   104 ITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQ 168
              ..|.||:: .:|....||.:::..    .||..:|.|.||:.|.||..|:....:::::::|.
 Worm   174 --FDGGGCSS-FVGRVGGTQGISIST----PGCDVVGIISHEIGHALGIFHEQARPDQERHIAIN 231

  Fly   169 WKNI--NPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNG-QPTIVPL-REGAENMGQ 229
            :.||  :...|...|..:::   ..::..||..|||||.|..|:.:. .|||..| |.....:||
 Worm   232 YNNIPLSRWNNFQAVGENHA---ETYNLPYDTGSVMHYGPYGFASDPYTPTIRTLERVQQSTIGQ 293

  Fly   230 RFYMSEKDIRKLNKMYRCPD 249
            |...|..|.:.:|..|.|.:
 Worm   294 RAGPSFLDYQAINMAYGCTE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 51/212 (24%)
ZnMc_astacin_like 55..245 CDD:239807 48/206 (23%)
nas-38NP_001359993.1 Astacin 122..313 CDD:366617 51/214 (24%)
CUB 367..466 CDD:214483
TSP1 613..658 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.