DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and dpy-31

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001022731.1 Gene:dpy-31 / 176014 WormBaseID:WBGene00006592 Length:592 Species:Caenorhabditis elegans


Alignment Length:305 Identity:82/305 - (26%)
Similarity:124/305 - (40%) Gaps:96/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ELFKDPELLA---------------GFYQGDIKAHPIRT----------------RNGIVNQIYH 52
            |..|:|||:|               .|:||||..:|.:.                |..|.:.:..
 Worm    71 ERHKNPELVAWDRKRDSVLNPEEQGKFFQGDIVLYPEQAKALYEQALTEGKTRVKRKFIGSNLRR 135

  Fly    53 W-PNRTVPYMIEDDAFADSHYREILRAISIIEEN----SCVIFKPATEMDFPMALVITSKGLGCN 112
            | .:|.:.|     ||..||.:...|.|.:..|:    :|:.|:...:.:....:|.|... ||.
 Worm   136 WDASRPIIY-----AFDGSHTQREQRIIELALEHWHNITCLNFQRNDQANSGNRIVFTDVD-GCA 194

  Fly   113 TVHLGYRNKTQVVNLEIYPLGE--------GCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQW 169
            :            |:..:||||        .|.|:|.|.||:.|.|||.|:....:|||||:::|
 Worm   195 S------------NVGRHPLGEEQLVSLAPECIRLGVIAHEVAHALGFWHEQSRPDRDQYVTVRW 247

  Fly   170 KNINPQYNINFVNNDNSTAWHDFDEG---YDYESVMHYVPRAFSRNGQPTIVP--LREGAENMGQ 229
            :||:......|:..|..    |.|..   |||.|:|||..:|||:......:.  :.:..:.:||
 Worm   248 ENIDKDSKGQFLKEDPD----DVDNAGVPYDYGSIMHYRSKAFSKFDDLYTISTYVTDYQKTIGQ 308

  Fly   230 RFYMSEKDIRKLNKMY-------------------------RCPD 249
            |..:|..|||.:||:|                         ||||
 Worm   309 RDQLSFNDIRLMNKIYCSAVCPSKLPCQRGGYTDPRRCDRCRCPD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 66/238 (28%)
ZnMc_astacin_like 55..245 CDD:239807 62/206 (30%)
dpy-31NP_001022731.1 Astacin 134..327 CDD:279708 64/214 (30%)
ZnMc_astacin_like 139..324 CDD:239807 62/206 (30%)
CUB 383..483 CDD:214483
TSP1 493..539 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.