DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and toh-1

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_497769.3 Gene:toh-1 / 175491 WormBaseID:WBGene00006591 Length:414 Species:Caenorhabditis elegans


Alignment Length:223 Identity:63/223 - (28%)
Similarity:103/223 - (46%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREIL-RAISIIEENSCVIFKPATEMDFP 99
            |.|..| |..|..|||.|.:..:|:.|..   .|.:::.:: |.|.:.|:::|:.||...:....
 Worm    55 KVHRHR-REVIAGQIYDWNSYEIPFQIWG---GDYNFQSLIRRGIRMWEDSTCLRFKENQQSRDA 115

  Fly   100 MALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQY 164
            :..|: .||..|.|.::|.....|.:     .:|..|.....:.||..|.|||.|.|...:||::
 Worm   116 IRYVL-EKGDSCFTEYIGRNGGHQDI-----IIGSECAEEYVVAHETGHALGFWHTHQRPDRDRH 174

  Fly   165 VSIQWKNINPQYNINFVNNDNSTAWHDFDE------GYDYESVMHYVPRAFS-RNGQPTIVPLR- 221
            :||.|||:..:...:|:...:........:      .|||.|:|||...|.: :....||||.. 
 Worm   175 ISINWKNVMEEATASFMPFRSMLQAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTIVPKEL 239

  Fly   222 EGAENMGQRFYMSEKDIRKLNKMYRCPD 249
            :....||.. .|:..|.:.:|.:| ||:
 Worm   240 KYVTTMGTE-KMAFLDAKVINDIY-CPN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 54/204 (26%)
ZnMc_astacin_like 55..245 CDD:239807 51/198 (26%)
toh-1NP_497769.3 Astacin 71..265 CDD:279708 54/204 (26%)
ZnMc_astacin_like 73..262 CDD:239807 51/198 (26%)
CUB 320..410 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.