DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and Mep1a

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_032611.2 Gene:Mep1a / 17287 MGIID:96963 Length:760 Species:Mus musculus


Alignment Length:235 Identity:82/235 - (34%)
Similarity:119/235 - (50%) Gaps:24/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLAG--FYQGDIKAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSCV 88
            |.||  .:||||...  ||||.:.:....| ...:||::.|:...::. ..||.|..:....|||
Mouse    60 LAAGLNLFQGDILLP--RTRNAMRDPSSRW-KLPIPYILADNLELNAK-GAILHAFEMFRLKSCV 120

  Fly    89 IFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFE 153
            .|||   .:...:.:|..|..||.:: :|.:...|.::     :||||....:|.||:||.|||.
Mouse   121 DFKP---YEGESSYIIFQKLSGCWSM-IGDQQVGQNIS-----IGEGCDFKATIEHEILHALGFF 176

  Fly   154 HQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQ-PTI 217
            |:....:||.||:|.|..|...|..||...|::|. .|.:..|||||:|||.|.:|::|.. |||
Mouse   177 HEQSRTDRDDYVNIWWDQIITDYEHNFNTYDDNTI-TDLNTPYDYESLMHYGPFSFNKNESIPTI 240

  Fly   218 -VPLREGAENMGQRFYMSEKDIRKLNKMYRCP------DH 250
             ..:.|....:||....|..|:.:||:||.|.      ||
Mouse   241 TTKIPEFNTIIGQLPDFSAIDLIRLNRMYNCTATHTLLDH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 69/203 (34%)
ZnMc_astacin_like 55..245 CDD:239807 65/191 (34%)
Mep1aNP_032611.2 ZnMc 46..271 CDD:381785 79/224 (35%)
MAM 281..444 CDD:366209 82/235 (35%)
MATH 443..607 CDD:351761
EGF 688..722 CDD:333761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.