DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-36

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_492109.2 Gene:nas-36 / 172506 WormBaseID:WBGene00003552 Length:617 Species:Caenorhabditis elegans


Alignment Length:251 Identity:66/251 - (26%)
Similarity:112/251 - (44%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLFTPTVFSELFKDPELLAGFYQGDIKAHPIRTRNGIV-NQIYHWPNRTVPYMIED--DAFADSH 71
            |||...:|....:..::|....:...|    |.|...| ::...|....:.|...:  |.:..| 
 Worm    96 FLFEGDIFLSRRQAVDILKALSKDKTK----RLRRSFVSDKTATWKTMPIKYRFHESIDFYTIS- 155

  Fly    72 YREILRAISIIEENSCVIFKPATEM---DFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLG 133
              :|:.||...|:::|:.|:..::.   |:    :....|.||.:: :|.....|.::     :|
 Worm   156 --QIIAAIRFWEDSTCITFENVSDSPDGDY----IEFFSGQGCYSM-IGRNGGRQGIS-----IG 208

  Fly   134 EGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDE---G 195
            |.|.::|.|.||:.|.||..|:....:...||:|:...|.|.|..:|:..|:     :.|.   .
 Worm   209 ESCVKMGVIEHEIGHALGLWHEQSRPDALGYVTIERDFILPSYISDFLQRDD-----EIDTLGIP 268

  Fly   196 YDYESVMHYVPRAFSRNGQPTIVPLREG--AENMGQRFYMSEKDIRKLNKMYRCPD 249
            ||..|||||...|||.:.:...|..|:.  .:.:|||..:|..|:..:|..| |.|
 Worm   269 YDLGSVMHYGSTAFSVDQKSKTVVTRDSLYQQTIGQREKLSFYDVATINTAY-CKD 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 56/205 (27%)
ZnMc_astacin_like 55..245 CDD:239807 53/199 (27%)
nas-36NP_492109.2 Astacin 134..323 CDD:279708 56/207 (27%)
ZnMc_astacin_like 140..320 CDD:239807 53/197 (27%)
CUB 380..478 CDD:214483
TSP1 510..556 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.