DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and astl2d.2

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031756346.1 Gene:astl2d.2 / 105947175 XenbaseID:XB-GENE-22069740 Length:517 Species:Xenopus tropicalis


Alignment Length:234 Identity:80/234 - (34%)
Similarity:112/234 - (47%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QGDIKAHPIRT-----------RNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEEN 85
            ||||.....|:           .||||         .|||.: |..::......|..|:.:....
 Frog    80 QGDIAVRVSRSTIVCTDCFWQKSNGIV---------YVPYTL-DKQYSSDQINTITSAMEVYSTL 134

  Fly    86 SCVIFKPAT-EMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEG-CFRIGSIIHELLH 148
            :||.|.|.| |.|:   :.||| |.||.: ::|.:...|||::|     :| |...|:.:|||.|
 Frog   135 TCVQFVPYTDEEDY---IAITS-GDGCWS-YMGRQGGAQVVSVE-----KGYCTSEGTTMHELNH 189

  Fly   149 VLGFEHQHVSQNRDQYVSIQWKNINPQYNINF----VNNDNSTAWHDFDEGYDYESVMHYVPRAF 209
            .|||.|:....:||.||.|.::.|:|...:||    .||.|:|        |||.|:|||...||
 Frog   190 ALGFVHEQSRSDRDNYVDIMYQYISPGDIVNFKKMETNNLNTT--------YDYHSIMHYPAWAF 246

  Fly   210 SR-NGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            |. .||.|||........:|....|:..||.|:|::|:|
 Frog   247 SNTTGQNTIVAKLNPNTPLGPGSTMTNLDITKINRLYQC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 71/202 (35%)
ZnMc_astacin_like 55..245 CDD:239807 69/196 (35%)
astl2d.2XP_031756346.1 ZnMc 103..285 CDD:412141 74/209 (35%)
CUB 288..399 CDD:238001
CUB 402..513 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.