DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and astl2d.4

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_004913426.2 Gene:astl2d.4 / 101734297 XenbaseID:XB-GENE-22069748 Length:537 Species:Xenopus tropicalis


Alignment Length:226 Identity:77/226 - (34%)
Similarity:113/226 - (50%) Gaps:30/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QGDIKAHPIRTRNGIVNQIYHWP--NRT--VPYMIEDDAFADSHYREILRAISIIEENSCVIFKP 92
            ||||.....|:.....|.:  ||  |.|  |||.: ||.::::....|..|:.:....:||.|.|
 Frog   100 QGDIAIGVSRSALNCTNCL--WPKTNGTVYVPYTL-DDEYSNNEVNTITAAMQVYATLTCVQFVP 161

  Fly    93 ATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEG-CFRIGSIIHELLHVLGFEHQH 156
            .|:.|..:|:   ....||.: ::|.:...|||::|     :| |...|:.:|||.|.|||.|:.
 Frog   162 YTDEDDYVAI---KSANGCWS-YMGRQGGAQVVSVE-----KGYCTSEGTTMHELNHALGFVHEQ 217

  Fly   157 VSQNRDQYVSIQWKNINPQYNINF----VNNDNSTAWHDFDEGYDYESVMHYVPRAFSR-NGQPT 216
            ...:||.||:|.::.|:|...:||    .||.|:.        |||.|:|||...|||. .||.|
 Frog   218 SRSDRDNYVNIMYQYISPGDIVNFEIMNTNNLNTI--------YDYRSIMHYPAWAFSNTTGQNT 274

  Fly   217 IVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            ||........:|....|:..||.|:|::|.|
 Frog   275 IVAKPNPNIIIGAGSTMTSLDIIKINRLYEC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 71/205 (35%)
ZnMc_astacin_like 55..245 CDD:239807 67/197 (34%)
astl2d.4XP_004913426.2 ZnMc_hatching_enzyme 123..305 CDD:239810 68/199 (34%)
CUB 308..417 CDD:395345
CUB 422..533 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.