DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and astl

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031755136.1 Gene:astl / 101730245 XenbaseID:XB-GENE-5769376 Length:972 Species:Xenopus tropicalis


Alignment Length:240 Identity:69/240 - (28%)
Similarity:113/240 - (47%) Gaps:40/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AGFYQGDI--KAHPIRTRNGIVNQIYHWP----NRTVPYMIEDDAFADSHYRE-----ILRAISI 81
            :|..:|||  :...|||.:.   :...||    :..:||.:      .|.|..     ||:|...
 Frog    52 SGLMEGDIVKEKRSIRTFSA---RFAKWPKINGSVIIPYTL------SSSYESFDRNIILKAFRD 107

  Fly    82 IEENSCVIF-KPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRI----GS 141
            ::.::|:.| :..||.|:    :.....:||      :.:..:|..:::..|...|.|.    |.
 Frog   108 LQASTCLRFVERTTERDY----IAIEPAIGC------FSSVGRVGGMQLVSLAFECLRTDKGKGI 162

  Fly   142 IIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVP 206
            .:|||:||.||.|:|...:||.|:.|.|..|...|..||.    ..|..:....|:.:|::||..
 Frog   163 ALHELMHVAGFWHEHSRADRDDYIWIIWDEILIGYEKNFC----KYATTNMLVKYELQSILHYPR 223

  Fly   207 RAFSRNGQPTIVPLREGAE-NMGQRFYMSEKDIRKLNKMYRCPDH 250
            .|||::||.||.|....:: .:|||..:|..||.::||:|.|..:
 Frog   224 SAFSKSGQATINPKYPYSKIEIGQREKLSASDILRVNKLYSCSQY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 62/210 (30%)
ZnMc_astacin_like 55..245 CDD:239807 58/200 (29%)
astlXP_031755136.1 ZnMc_astacin_like 84..263 CDD:239807 58/198 (29%)
MAM 817..971 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.