DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and XB5917669

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031756322.1 Gene:XB5917669 / 100496293 XenbaseID:XB-GENE-5917670 Length:578 Species:Xenopus tropicalis


Alignment Length:259 Identity:80/259 - (30%)
Similarity:121/259 - (46%) Gaps:51/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FSELFKDPELLAGFYQGDIKAHPIR------------------TRNGIVNQIYHW--PNRT--VP 59
            |.|...||     |.|||:.:..::                  :|:.|.:....|  .|.|  ||
 Frog   111 FLEGKSDP-----FGQGDVFSRILKANQGNGVPRVQEDIAVGVSRSAITSTECLWQKTNETVYVP 170

  Fly    60 YMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQV 124
            |.: |..:::|....:..|:.:....:||.|.|.|:.|   ..|..:.|.||.: ::|.:...||
 Frog   171 YTL-DSKYSNSEVNTMTSAMEVYATLTCVQFVPYTDED---DYVNITSGDGCWS-YMGRQGGAQV 230

  Fly   125 VNLEIYPLGEG-CFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINF----VNND 184
            |::|     :| |...|:.:|||.|.|||.|:|...:||.||:|.::.|:|...:||    .||.
 Frog   231 VSVE-----KGYCTSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVNFEIMNTNNL 290

  Fly   185 NSTAWHDFDEGYDYESVMHYVPRAFSR-NGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            |:.        |||.|:|||...|||. .|:.|||........:|....|:..||.|:|::|.|
 Frog   291 NTI--------YDYRSIMHYPAWAFSNTTGKNTIVAKLNPNIIIGAGSTMTSLDIIKINRLYEC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 70/205 (34%)
ZnMc_astacin_like 55..245 CDD:239807 67/197 (34%)
XB5917669XP_031756322.1 C2 92..>113 CDD:417471 1/1 (100%)
ZnMc 164..346 CDD:412141 68/199 (34%)
CUB 349..458 CDD:395345
CUB 463..574 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.