DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and accs

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017948750.2 Gene:accs / 100495810 XenbaseID:XB-GENE-989873 Length:492 Species:Xenopus tropicalis


Alignment Length:276 Identity:80/276 - (28%)
Similarity:125/276 - (45%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PQIWGVIFLFTPTVFSEL----FKDPELLAGFYQGDIKAHPIRTRNGIVNQIYH----------- 52
            |.:.|.|..  |....:|    ::|.|.    |..|:.:..:::.||.|.:::.           
 Frog     5 PLLIGCICF--PVAVDQLPSGNYEDEEA----YHEDVFSQILKSNNGTVKKLWQGDIAIETGRSA 63

  Fly    53 -------WPNRT-----VPYMIEDDAFADSHYREILRAISIIEENSCVIF-KPATEMDFPMALVI 104
                   ||...     |||.:..| ::|:....|..|:......:||.| :.:||.||   |.|
 Frog    64 TKCTSCLWPKSADGTVRVPYRLSAD-YSDNEKSSIRDALLEFNTLTCVHFVERSTEEDF---LDI 124

  Fly   105 TSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQW 169
            .|.. ||.: .:|.....|.::|    :..||...|.|.||:.|.|||.|:....:||.|:.:.|
 Frog   125 VSDS-GCWS-SIGRTGGAQTLSL----MSSGCLAKGIIQHEVDHALGFYHEQSRSDRDTYIDVLW 183

  Fly   170 KNI--NPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSR-NGQPTIVPLREGAENMGQRF 231
            :.|  :...:...|:.||      .|..|||.|||||...|||. :|||::.|..:...|:|||:
 Frog   184 QYICESDWGSFEMVDTDN------LDLPYDYSSVMHYGWYAFSNTSGQPSLRPKPDPTANIGQRY 242

  Fly   232 YMSEKDIRKLNKMYRC 247
            .:|..|:.|:.::|.|
 Frog   243 GLSPLDVSKVKELYGC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 68/204 (33%)
ZnMc_astacin_like 55..245 CDD:239807 64/198 (32%)
accsXP_017948750.2 ZnMc 76..258 CDD:412141 65/197 (33%)
CUB 261..374 CDD:238001
CUB 377..488 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.