DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and astl3c

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002937470.2 Gene:astl3c / 100491451 XenbaseID:XB-GENE-22069695 Length:533 Species:Xenopus tropicalis


Alignment Length:229 Identity:82/229 - (35%)
Similarity:106/229 - (46%) Gaps:38/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GDIKAHPIRTRNGIVNQIYHWPNR-----TVPYMIEDDAFADSHYREIL---RAISIIEENSCVI 89
            |||.   |.......:..|.||..     .|||:...:..||    |:.   .|:...|..:||.
 Frog    77 GDIL---INIGRSATSSDYLWPKSADGTVVVPYIFSYNYSAD----ELTLFKTAMQEFETLTCVR 134

  Fly    90 FKPAT-EMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFE 153
            |.|.| :.||   |.|.|.| ||.:: :|.....|.|.|..|    ||...|.|.|||.|.|||.
 Frog   135 FVPKTIQRDF---LNIVSNG-GCLSM-VGRNGGGQKVELASY----GCMSRGVIQHELNHALGFY 190

  Fly   154 HQHVSQNRDQYVSIQWKNINPQYNINF----VNNDNSTAWHDFDEGYDYESVMHYVPRAFSRN-G 213
            |:|:..:||.||:|..:||.|.|...|    .||....        |||.|||||....||.: .
 Frog   191 HEHMRSDRDDYVTIITENIIPSYENYFSKRKTNNMGII--------YDYNSVMHYSRNTFSISPD 247

  Fly   214 QPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            :.||||..:.:..:|||..:|..||.|:.|:|:|
 Frog   248 KSTIVPKPDPSIPIGQRDGLSILDILKIKKLYQC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 77/209 (37%)
ZnMc_astacin_like 55..245 CDD:239807 73/203 (36%)
astl3cXP_002937470.2 ZnMc 99..281 CDD:381785 74/202 (37%)
CUB 290..393 CDD:366096
CUB 398..508 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.