DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and astl3b.2

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031746779.1 Gene:astl3b.2 / 100491112 XenbaseID:XB-GENE-22069683 Length:529 Species:Xenopus tropicalis


Alignment Length:241 Identity:87/241 - (36%)
Similarity:119/241 - (49%) Gaps:27/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFSELFK-DPELLAGFYQGDIKAHPIRTRNGIVNQIYHWPNRT-----VPYMIEDDAFAD--SHY 72
            ||:::.| :..:....|||||.....|:.......:  ||..|     |||....:..||  :.:
 Frog    80 VFTQISKVNRGIRVPTYQGDILRPKGRSAMNCTECL--WPKSTDGTVIVPYNFSSNYSADQLALF 142

  Fly    73 REILRAISIIEENSCVIFKP-ATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGC 136
            :..::.   .|..:||.|.| |.|.||   |.|.|.. ||.: .||.....|.|.|:.|    ||
 Frog   143 KSTMQE---YESLTCVRFVPRANETDF---LSIVSDN-GCAS-FLGKVGGDQTVQLDSY----GC 195

  Fly   137 FRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESV 201
            ...|.|.|||.|.|||.|:....:||.||:|..:||.|.|..||...|::....:    |||.||
 Frog   196 IYRGIIQHELNHALGFYHEQSRSDRDDYVTIHTENIIPGYEGNFNKADSNNLGLE----YDYSSV 256

  Fly   202 MHYVPRAFSRNGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            |||...|||:||..||||..:....:|||..:|..|:.|:|::|:|
 Frog   257 MHYPGDAFSKNGNLTIVPKPDPTVPIGQRDGLSILDVSKINRLYQC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 78/203 (38%)
ZnMc_astacin_like 55..245 CDD:239807 74/197 (38%)
astl3b.2XP_031746779.1 ZnMc_hatching_enzyme 121..302 CDD:239810 74/196 (38%)
CUB 306..414 CDD:238001
CUB 419..527 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.