DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and XB5949052

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002932488.2 Gene:XB5949052 / 100489456 XenbaseID:XB-GENE-5949053 Length:453 Species:Xenopus tropicalis


Alignment Length:253 Identity:83/253 - (32%)
Similarity:121/253 - (47%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TVFSELF---KDPELLAGFY---QGDIKAHPIRTRNGIVNQIYHWPNRT-----VPYMIEDDAFA 68
            ::|..|:   ||.....|.|   ..||.....::.|.....|..||..:     :||:|..|.  
 Frog    43 SMFDRLYEVNKDALPFTGKYIVSNLDIALKLGKSANTCPKGICLWPKSSDGLVRIPYVISSDY-- 105

  Fly    69 DSHYREILRAISI--IEENSCVIFKPAT-EMDFPMALVITSKGL-GCNTVHLGYRNKTQVVNLEI 129
             |.|...|...|.  ..:.:|:...|.| |.|:     ::.:.| ||.: .:|.....|.|::: 
 Frog   106 -SSYSNALFQASFKGFADTTCIRLVPRTSETDY-----LSFESLNGCWS-PIGRTGGAQTVSVQ- 162

  Fly   130 YPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINF----VNNDNSTAWH 190
               ..||.....|.||::|.||..|:||..:||:|||:||.||:|....||    .||.|.|.  
 Frog   163 ---QSGCMWTSIIEHEIIHSLGLHHEHVRSDRDKYVSVQWNNISPGNTGNFQMTDTNNMNLTK-- 222

  Fly   191 DFDEGYDYESVMHYVPRAFSRNGQ-PTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
                 |||.|:|||...|||.||. ||::.:.:.:.:.|..|.||:.||:|||.:|:|
 Frog   223 -----YDYNSLMHYSSTAFSINGNLPTLIAVPDSSVSFGNAFMMSDLDIKKLNTLYKC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 73/209 (35%)
ZnMc_astacin_like 55..245 CDD:239807 69/203 (34%)
XB5949052XP_002932488.2 ZnMc 92..275 CDD:412141 70/202 (35%)
CUB 342..452 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.