DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and LOC100488711

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031756326.1 Gene:LOC100488711 / 100488711 -ID:- Length:497 Species:Xenopus tropicalis


Alignment Length:253 Identity:78/253 - (30%)
Similarity:119/253 - (47%) Gaps:51/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DPELLAGFYQGDIKAHPIR------------------TRNGIVNQIYHW--PNRT--VPYMIEDD 65
            ||     |.|||:.:..::                  :|:.|.:....|  .|.|  |||.: |.
 Frog    35 DP-----FGQGDVFSRILKANQGNGVPRVQEDIAVGVSRSAITSTECLWQKTNETVYVPYTL-DS 93

  Fly    66 AFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIY 130
            .:::|....:..|:.:....:||.|.|.|:.|   ..|..:.|.||.: ::|.:...|||::|  
 Frog    94 KYSNSEVNTMTSAMEVYATLTCVQFVPYTDED---DYVNITSGDGCWS-YMGRQGGAQVVSVE-- 152

  Fly   131 PLGEG-CFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINF----VNNDNSTAWH 190
               :| |...|:.:|||.|.|||.|:|...:||.||:|.::.|:|...:||    .||.|:.   
 Frog   153 ---KGYCTSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVNFEIMNTNNLNTI--- 211

  Fly   191 DFDEGYDYESVMHYVPRAFSR-NGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
                 |||.|:|||...|||. .|:.|||........:|....|:..||.|:|::|.|
 Frog   212 -----YDYRSIMHYPAWAFSNTTGKNTIVAKLNPNIIIGAGSTMTSLDIIKINRLYEC 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 70/205 (34%)
ZnMc_astacin_like 55..245 CDD:239807 67/197 (34%)
LOC100488711XP_031756326.1 ZnMc 82..264 CDD:412141 68/199 (34%)
CUB 276..373 CDD:214483
CUB 378..489 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.