DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and mep1ba

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001070089.2 Gene:mep1ba / 100151009 ZFINID:ZDB-GENE-041014-209 Length:677 Species:Danio rerio


Alignment Length:235 Identity:78/235 - (33%)
Similarity:121/235 - (51%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ELFKDPELLAG--FYQGDIKAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISI 81
            ::|:..| :||  ..:|||......:||.|:.:.|.||. ||||.: |::...:....||:|...
Zfish    39 DIFEINE-VAGLDLVEGDILIEEGESRNTILGEQYRWPT-TVPYFL-DNSLEINAKGVILKAFEQ 100

  Fly    82 IEENSCVIFKPAT-EMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHE 145
            ....:|:.|||.. |.::    :...||.||.: .:|.|   |:...|: .:|..|..:|::.||
Zfish   101 YRLKTCIDFKPWNGESNY----IFVFKGSGCYS-KVGNR---QMGKQEL-SIGSNCDSLGTVEHE 156

  Fly   146 LLHVLGFEHQHVSQNRDQYVSIQWKNI--NPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRA 208
            .||.||..|:....:||.||.|.|..|  ..::|.|..:...|::   ....|||.|||||...:
Zfish   157 FLHALGLWHEQSRSDRDDYVIIVWDQIQDGKEHNFNLYDETQSSS---LGVPYDYSSVMHYSKTS 218

  Fly   209 FSRNGQPTIV-PLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            |::..:|||| .:.|....:|||...|:.|:.|||::|.|
Zfish   219 FNKGSEPTIVTKIPEFLNVIGQRMEFSDNDLLKLNRLYNC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 67/199 (34%)
ZnMc_astacin_like 55..245 CDD:239807 63/193 (33%)
mep1baNP_001070089.2 ZnMc_meprin 29..258 CDD:239809 77/233 (33%)
Astacin 72..260 CDD:279708 68/201 (34%)
MAM 268..432 CDD:279023
MAM 268..430 CDD:99706
MATH_Meprin_Beta 430..599 CDD:239751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.