DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WDR86 and CG7568

DIOPT Version :10

Sequence 1:NP_001271189.1 Gene:WDR86 / 349136 HGNCID:28020 Length:482 Species:Homo sapiens
Sequence 2:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster


Alignment Length:286 Identity:85/286 - (29%)
Similarity:122/286 - (42%) Gaps:57/286 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    29 RLLTGSEDGTARLWSTADGQCCALLQGHESYVT---FCQLEDEAAFTCSADCTIRRWDVLTGQCL 90
            :::|||.||||::||...||......||.:.:.   |..::.::..|.|.|.:.|.:||.|...|
  Fly   196 KIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHEL 260

Human    91 Q--VYRGHTSIVNRILVANNQLFSSSYDRTARVWSVDKGQMSREFRGH----RNCVLTLAYSAPW 149
            |  .:.|...|..|.......|.:.|:|.:|.:|.|....:..:.|||    .|||        |
  Fly   261 QQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCV--------W 317

Human   150 DLPSTPCAEEAAAGGLLVTGSTDGTAKVWQVASGCCHQTL---RGHTGAVLCLVLDTPGHTAFTG 211
            :.          :|.|:.|||.|.||::|....  ..|.|   ..|:..||.:..|..|....|.
  Fly   318 NF----------SGSLIATGSLDNTARIWDTRK--LDQELYLAARHSDEVLDVSFDAAGQLLATC 370

Human   212 STDATIRAWDILSGEQLRVFREHRG-----SVICLERERSGGLQSCPS-CRPSLLLLAAGEPTRV 270
            |:|.|.|.|.:....:|.:.....|     |.:|..          || |   :||.|:.:.|..
  Fly   371 SSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFS----------PSGC---MLLTASADNTAR 422

Human   271 LW--QRGQDRQVLAGRHRG---VCAH 291
            ||  :.||..||||| |.|   .||:
  Fly   423 LWLTESGQCSQVLAG-HEGEVFSCAY 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WDR86NP_001271189.1 WD40 4..241 CDD:238121 64/228 (28%)
WD40 repeat 61..95 CDD:293791 10/38 (26%)
WD40 repeat 100..134 CDD:293791 7/33 (21%)
WD40 repeat 145..190 CDD:293791 12/47 (26%)
WD40 repeat 196..232 CDD:293791 11/35 (31%)
WD40 repeat 248..274 CDD:293791 9/28 (32%)
CG7568NP_001263071.1 WD40 117..467 CDD:441893 85/286 (30%)
WD40 repeat 122..158 CDD:293791
WD40 repeat 189..222 CDD:293791 11/25 (44%)
WD40 repeat 228..265 CDD:293791 10/36 (28%)
WD40 repeat 270..306 CDD:293791 8/35 (23%)
WD40 repeat 314..348 CDD:293791 15/53 (28%)
WD40 repeat 355..393 CDD:293791 11/37 (30%)
WD40 repeat 400..436 CDD:293791 15/48 (31%)
WD40 repeat 442..466 CDD:293791 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.