DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WDR86 and CG10931

DIOPT Version :10

Sequence 1:NP_001271189.1 Gene:WDR86 / 349136 HGNCID:28020 Length:482 Species:Homo sapiens
Sequence 2:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster


Alignment Length:165 Identity:36/165 - (21%)
Similarity:50/165 - (30%) Gaps:63/165 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   295 RAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKI 359
            |.|||..|.        .|..|.:||       ||           |....::.|:.:..  ..|
  Fly    61 RNAGNLVPH--------AEHFQDEYF-------SC-----------EPAALELGCVVNNI--KHI 97

Human   360 PTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKV 424
            ..|...||:|                     ..:.|..::|.:..|:|.    ..|....|:.:.
  Fly    98 IVCGHSDCKA---------------------MNLLYKLKDPEFASLDNR----RISPLRAWLCEH 137

Human   425 LGRSLPTC--LPVCGLPK---FS-----RKLMARI 449
            ...||...  |...||.|   ||     ||.:|.|
  Fly   138 ANTSLAKFQNLKEIGLDKPLIFSSETPLRKFVAYI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WDR86NP_001271189.1 WD40 4..241 CDD:238121
WD40 repeat 61..95 CDD:293791
WD40 repeat 100..134 CDD:293791
WD40 repeat 145..190 CDD:293791
WD40 repeat 196..232 CDD:293791
WD40 repeat 248..274 CDD:293791
CG10931NP_611261.1 WD40 <47..340 CDD:441893 36/165 (22%)
WD40 repeat 59..96 CDD:293791 13/62 (21%)
WD40 repeat 102..137 CDD:293791 9/59 (15%)
WD40 repeat 142..178 CDD:293791 11/31 (35%)
WD40 repeat 185..220 CDD:293791
WD40 repeat 227..263 CDD:293791
WD40 repeat 271..309 CDD:293791
WD40 repeat 314..340 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.