DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WDR86 and SCAP

DIOPT Version :10

Sequence 1:NP_001271189.1 Gene:WDR86 / 349136 HGNCID:28020 Length:482 Species:Homo sapiens
Sequence 2:NP_788277.1 Gene:SCAP / 35529 FlyBaseID:FBgn0033052 Length:1276 Species:Drosophila melanogaster


Alignment Length:337 Identity:76/337 - (22%)
Similarity:120/337 - (35%) Gaps:100/337 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    12 ADHRGGINWLSLSPDGQRLLTGSEDGTARLWSTADGQCCALLQGHESYVT--------------- 61
            |.|:..|.  .|..||..:::....|..|:|....|:....:...:..::               
  Fly   880 AGHKHRIE--CLVSDGAYIISCCLKGQIRVWDARSGEQLTSISRSDIQISQQRTDGQTLVRKLAV 942

Human    62 ---FC--QLEDEAAFTCSADCTIRRWDVLTGQCLQVY-------RGHTSI---VNRILVA--NNQ 109
               :|  ..::..|..| |:..:..|:...|.....|       :|.|.|   .:|::||  |.:
  Fly   943 SPVWCLDYFDNLIAVGC-ANGRVELWESPAGLLKCAYQEDAKRNQGITHIHLNGDRVIVARLNGR 1006

Human   110 L-----------------FSSSYDRT-ARVWS--------------------VDKGQMSREFRGH 136
            |                 |:|:|.|| .|..|                    ..|.:|.....|.
  Fly  1007 LDFYRLETYYKGKQIDWGFTSAYRRTHVRTGSTGSLGLMLQQQRCQQEASQKTTKEEMKITLEGV 1071

Human   137 RNCVLTLAYSAPWDLPSTPCAEEAAAGGLLVTGSTDGTAKVWQVASGCCHQTLRGHTGAVLCLVL 201
            |     ||:..|     ..|.:  ....::.|||.|.|.||:.:.......||.||.|.|.||.:
  Fly  1072 R-----LAHQQP-----ITCMQ--VVNDMVFTGSQDHTLKVYCLNKSDVEYTLHGHCGPVTCLFV 1124

Human   202 D--TPGHTAFTGSTDATIRAWDILSGEQLRVFREHRGSVICLERERSGGLQSCPSCRPSLLLLAA 264
            |  .|| |..:||.|..:..||:.:|..:...:.|.|:|.||            :|.||.::...
  Fly  1125 DRWQPG-TGGSGSQDGLLCVWDLFTGACMYNIQAHDGAVSCL------------ACAPSYVISLG 1176

Human   265 GEPTRVLWQRGQ 276
            .:....:|:|.|
  Fly  1177 TDERICVWERFQ 1188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WDR86NP_001271189.1 WD40 4..241 CDD:238121 68/300 (23%)
WD40 repeat 61..95 CDD:293791 7/60 (12%)
WD40 repeat 100..134 CDD:293791 14/73 (19%)
WD40 repeat 145..190 CDD:293791 10/44 (23%)
WD40 repeat 196..232 CDD:293791 13/37 (35%)
WD40 repeat 248..274 CDD:293791 4/25 (16%)
SCAPNP_788277.1 Sterol-sensing 390..543 CDD:463544
WD40 878..1185 CDD:475233 73/332 (22%)
WD40 repeat 887..942 CDD:293791 7/56 (13%)
WD40 repeat 945..983 CDD:293791 7/38 (18%)
WD40 repeat 989..1070 CDD:293791 16/80 (20%)
WD40 repeat 1079..1114 CDD:293791 10/36 (28%)
WD40 repeat 1120..1157 CDD:293791 12/37 (32%)
WD40 repeat 1162..1196 CDD:293791 9/39 (23%)
WD40 repeat 1201..1233 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.