DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and Bmp1

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_112613.1 Gene:Bmp1 / 83470 RGDID:620739 Length:990 Species:Rattus norvegicus


Alignment Length:317 Identity:94/317 - (29%)
Similarity:144/317 - (45%) Gaps:75/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLLLQVVLNSGKPLPAGVY----------------DPEEAGGFVEGDMMLTEEQQR--NLEQGA- 54
            :|||.::..:|:||....|                ||.:|..|: ||:.|.||..|  .::|.| 
  Rat    16 LLLLLLLPRAGRPLDLADYTYDLGEEDAPELLNYKDPCKAAAFL-GDIALDEEDLRAFRVQQAAV 79

  Fly    55 ----------------------------------------PKARNGLINTEKR-WPGNVVVYRIS 78
                                                    |::|....:..:| ||..|:.:.|.
  Rat    80 LRQQTAQRSSIKAAGNSSALGRQSTSGQPQRGSRGRWRSRPRSRRAATSRPERVWPDGVIPFVIG 144

  Fly    79 DDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQ-GAPQEMNLEIY 142
            .:|..:.:...:..:...|.|||:.|.|.|||| :|:..|.:..||.:.||.: |.||.::    
  Rat   145 GNFTGSQRAVFRQAMRHWEKHTCVTFLERTDED-SYIVFTYRPCGCCSYVGRRGGGPQAIS---- 204

  Fly   143 PLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGY 207
             :|:.|.:.|.::||..|.:||:|:.:...||..::::.|||.||:|:||.|.....|......|
  Rat   205 -IGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETY 268

  Fly   208 DYDSCLHYRPGAFSING--EDTIVP-LDSSAV---IGQRVGLSSKDIDKINIMYKCP 258
            |:||.:||....|| .|  .||||| .:.:.|   ||||..||..||.:...:||||
  Rat   269 DFDSIMHYARNTFS-RGIFLDTIVPKYEVNGVKPSIGQRTRLSKGDIAQARKLYKCP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 71/199 (36%)
ZnMc_astacin_like 70..255 CDD:239807 66/191 (35%)
Bmp1NP_112613.1 ZnMc_BMP1_TLD 125..324 CDD:239808 71/205 (35%)
Astacin 132..325 CDD:279708 73/200 (37%)
CUB 326..435 CDD:278839
CUB 439..548 CDD:278839
FXa_inhibition 559..591 CDD:291342
CUB 595..704 CDD:278839
FXa_inhibition 711..746 CDD:291342
CUB 751..860 CDD:278839
CUB 864..977 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.