DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and LOC797085

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001373298.1 Gene:LOC797085 / 797085 -ID:- Length:285 Species:Danio rerio


Alignment Length:230 Identity:76/230 - (33%)
Similarity:110/230 - (47%) Gaps:30/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWP---GNV-VVYRISDDFD--TAHKKAIQTGID 94
            |:.|.....|::..:.|....|.|.|      ||   |.| |.|.|:...:  |.|   |...:.
Zfish    76 VDSDEGYALEEEDIIPQTDRNAGNHL------WPEKDGEVSVPYSIASGLEDKTGH---ILAALK 131

  Fly    95 TLELHTCLRF-REATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEF 158
            .:...||::| ...|:||..:......   |.:.||..|..|.:     .:|..| ..|.|.||.
Zfish   132 MVSKKTCVKFHHHTTEEDYLHFKPDRM---CASLVGCAGGEQPI-----LVGPKC-NAGNICHEI 187

  Fly   159 MHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQ-KYADTVVTDFEVGYDYDSCLHYRPGAFSI 222
            :|:||.||:.|...||.:|.::|:||:||||.||: |..:|:..:    ||.||.|||....||.
Zfish   188 LHSLGLYHEHSRPDRDKYITILYDNIMPGKESNFKVKKGNTLGLE----YDLDSILHYGDDCFSR 248

  Fly   223 NGEDTIVPLDSSAVIGQRVGLSSKDIDKINIMYKC 257
            ||..||:|......||||..:|..|::::..:|.|
Zfish   249 NGNHTIIPKKKGVKIGQRTHMSVLDVERLRRLYHC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 69/200 (35%)
ZnMc_astacin_like 70..255 CDD:239807 65/189 (34%)
LOC797085NP_001373298.1 ZnMc_astacin_like 111..281 CDD:239807 63/185 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.