DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and c6ast1

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001036784.1 Gene:c6ast1 / 751088 ZFINID:ZDB-GENE-070621-1 Length:260 Species:Danio rerio


Alignment Length:195 Identity:78/195 - (40%)
Similarity:112/195 - (57%) Gaps:15/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RWP----GNVVV-YRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYT 126
            :||    |.|.| |.|||::.|..|..|..|..:||..||:|||..|.: :.|:.:...| |||:
Zfish    71 KWPLSSNGKVFVPYIISDEYSTQEKDVIFQGFRSLEKSTCVRFRPRTTQ-RDYINIEPNS-GCYS 133

  Fly   127 AVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFN 191
            .||.:...|.::|:    .:||.:...:.||.:|.|||:|:.:.|.||..:.::|:||:||:|.|
Zfish   134 FVGRRTGGQTVSLD----HDGCIKLNIVQHELLHTLGFHHEHNRSDRDSHVQIVYKNIIPGQERN 194

  Fly   192 FQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVPL-DSSAVIGQRVGLSSKDIDKINIMY 255
            |.|..   ..:.|..|||.|.:||...|||.|.|.||||: ||...||:...:||.||.:||.:|
Zfish   195 FDKIK---TNNLETAYDYSSVMHYGRFAFSKNKEATIVPIPDSGVTIGRAKRMSSNDILRINRLY 256

  Fly   256  255
            Zfish   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 78/195 (40%)
ZnMc_astacin_like 70..255 CDD:239807 75/186 (40%)
c6ast1NP_001036784.1 Astacin 71..259 CDD:279708 78/195 (40%)
ZnMc_hatching_enzyme 77..257 CDD:239810 76/189 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.