DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and TLL2

DIOPT Version :10

Sequence 1:NP_609755.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_036597.1 Gene:TLL2 / 7093 HGNCID:11844 Length:1015 Species:Homo sapiens


Alignment Length:213 Identity:77/213 - (36%)
Similarity:118/213 - (55%) Gaps:15/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 APKARNGLIN-TEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTV 117
            :|:.|....: ||:.|||.|:.|.|..:|..:.:...:..:...|.|||:.|.|.|||: :::..
Human   144 SPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEE-SFIVF 207

  Fly   118 TAKSGGCYTAVGYQ-GAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIY 181
            :.::.||.:.||.: |.||.::     :|:.|.:.|.:.||..|.:||:|:.:...||..:.:|.
Human   208 SYRTCGCCSYVGRRGGGPQAIS-----IGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIR 267

  Fly   182 ENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGE--DTIVP-LDSSAV---IGQR 240
            |||.||:|:||.|.....|:.....||:||.:||....|| .|.  |||:| .|.:.|   ||||
Human   268 ENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFS-RGVFLDTILPRQDDNGVRPTIGQR 331

  Fly   241 VGLSSKDIDKINIMYKCP 258
            |.||..||.:...:||||
Human   332 VRLSQGDIAQARKLYKCP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_609755.1 ZnMc_astacin_like 70..255 CDD:239807 67/191 (35%)
TLL2NP_036597.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..130
ZnMc_BMP1_TLD 150..349 CDD:239808 73/205 (36%)
CUB 351..460 CDD:395345
CUB 464..573 CDD:395345
FXa_inhibition 580..616 CDD:464251
CUB 620..729 CDD:395345
FXa_inhibition 736..771 CDD:464251
CUB 776..885 CDD:395345
CUB 889..1002 CDD:395345
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.