DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and BMP1

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens


Alignment Length:320 Identity:93/320 - (29%)
Similarity:141/320 - (44%) Gaps:79/320 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLQVVL--NSGKPL----------------PAGVYDPEEAGGFVEGDMMLTEEQQRNLE----- 51
            |||.::|  ..|:||                |....||.:|..|: ||:.|.||..|..:     
Human     9 LLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFL-GDIALDEEDLRAFQVQQAV 72

  Fly    52 ----------------------------------------QGAPKARNGLINTEKR-WPGNVVVY 75
                                                    :|..::|....:..:| ||..|:.:
Human    73 DLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPF 137

  Fly    76 RISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQ-GAPQEMNL 139
            .|..:|..:.:...:..:...|.|||:.|.|.|||| :|:..|.:..||.:.||.: |.||.:: 
Human   138 VIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDED-SYIVFTYRPCGCCSYVGRRGGGPQAIS- 200

  Fly   140 EIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFE 204
                :|:.|.:.|.::||..|.:||:|:.:...||..::::.|||.||:|:||.|.....|....
Human   201 ----IGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLG 261

  Fly   205 VGYDYDSCLHYRPGAFSING--EDTIVP-LDSSAV---IGQRVGLSSKDIDKINIMYKCP 258
            ..||:||.:||....|| .|  .||||| .:.:.|   ||||..||..||.:...:||||
Human   262 ETYDFDSIMHYARNTFS-RGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 71/199 (36%)
ZnMc_astacin_like 70..255 CDD:239807 66/191 (35%)
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808 71/205 (35%)
Astacin 128..321 CDD:279708 73/200 (37%)
CUB 322..431 CDD:278839
CUB 435..544 CDD:278839
FXa_inhibition 555..587 CDD:291342
CUB 591..700 CDD:278839
FXa_inhibition 707..742 CDD:291342
CUB 747..856 CDD:278839
CUB 860..973 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.