DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and bmp1a

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001035126.1 Gene:bmp1a / 572452 ZFINID:ZDB-GENE-060818-1 Length:986 Species:Danio rerio


Alignment Length:308 Identity:92/308 - (29%)
Similarity:139/308 - (45%) Gaps:70/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VVLNSGKPLPAGVYDPEEAGGFVE--------------------GDMMLTEEQQR--------NL 50
            ::|:|...|.|...|..|.|.:||                    ||:.|.||..|        ||
Zfish     9 LLLSSFSLLAALDLDAIEPGYYVETSSPSDLIDYKDPCKAVAYLGDIALDEEDMRMFTVDRIVNL 73

  Fly    51 ---------------------------EQGAPKARNGLINTEKR-WPGNVVVYRISDDFDTAHKK 87
                                       .:|:.:.|....:..:| ||..|:.|.||.:|..:.:.
Zfish    74 AERTVTILNHTNTGSLSNETSVNTTASSRGSHRRRRAATSRPERVWPEGVIPYVISGNFSGSQRA 138

  Fly    88 AIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQ-GAPQEMNLEIYPLGEGCFRP 151
            ..:..:...|.|||:.|.|.|.|: :|:..|.:..||.:.||.: |.||.::     :|:.|.:.
Zfish   139 IFRQAMRHWEKHTCVTFIERTTEE-SYIVFTYRPCGCCSYVGRRGGGPQAIS-----IGKNCDKF 197

  Fly   152 GTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYR 216
            |.::||..|.:||:|:.:...||:.:::|.:||.||:|:||.|.....|......||:||.:||.
Zfish   198 GIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQPGQEYNFLKMEPGEVDSLGEVYDFDSIMHYA 262

  Fly   217 PGAFSING--EDTIVP-LDSSAV---IGQRVGLSSKDIDKINIMYKCP 258
            ...|| .|  .|||:| .|.:.|   ||||..||..||.:...:||||
Zfish   263 RNTFS-RGIFLDTILPRYDVNGVRPPIGQRTRLSKGDIAQARKLYKCP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 71/199 (36%)
ZnMc_astacin_like 70..255 CDD:239807 66/191 (35%)
bmp1aNP_001035126.1 ZnMc_BMP1_TLD 112..309 CDD:239808 71/203 (35%)
Astacin 117..309 CDD:279708 71/198 (36%)
CUB 311..420 CDD:278839
CUB 424..533 CDD:278839
FXa_inhibition 544..576 CDD:291342
CUB 580..699 CDD:278839
FXa_inhibition 706..741 CDD:291342
CUB 746..855 CDD:278839
CUB 859..972 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.