DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and he1.1

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001038639.1 Gene:he1.1 / 569018 ZFINID:ZDB-GENE-021211-3 Length:263 Species:Danio rerio


Alignment Length:277 Identity:95/277 - (34%)
Similarity:127/277 - (45%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLLLQVVLNSGKPL----PAGVYDPE--------------EAGGFVEGDMMLTEEQQRNLEQGAP 55
            :|||...|:...||    ...|.:||              .:....|||::|            |
Zfish     9 ILLLLFGLSQASPLREFEAVFVSEPETVDITAQILETNKGSSEVLFEGDVVL------------P 61

  Fly    56 KARNGLINTEKR--WPGNV-----VVYRISDDFDTAHKKAIQTGIDTLELHTCLRF-REATDEDK 112
            |.||..|..:|.  |..|.     |.|.:|.:|....|..|...|......||:|| ..:...| 
Zfish    62 KNRNAFICEDKSCFWKKNANNIVEVPYVVSGEFSINDKSVIANAISIFHAQTCIRFVPRSIQAD- 125

  Fly   113 AYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFI 177
             ||::..|. |||:|:|..|..|.::|.    .:||...|...||..|||||||:||.|.||.::
Zfish   126 -YLSIENKD-GCYSAIGRTGGKQVVSLN----RKGCVYSGIAQHELNHALGFYHEQSRSDRDQYV 184

  Fly   178 NVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSIN-GEDTIVPL-DSSAVIGQR 240
            .:.:.||.||..:||.|..   ..:....|||.|.:||...||:|. |.:||.|: |.:..||||
Zfish   185 RINWNNISPGMAYNFLKQK---TNNQNTPYDYGSLMHYGKTAFAIQPGLETITPIPDENVQIGQR 246

  Fly   241 VGLSSKDIDKINIMYKC 257
            .|||..||.:||.:|.|
Zfish   247 QGLSKIDILRINKLYGC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 77/202 (38%)
ZnMc_astacin_like 70..255 CDD:239807 73/192 (38%)
he1.1NP_001038639.1 ZnMc_hatching_enzyme 81..263 CDD:239810 73/191 (38%)
Astacin 86..263 CDD:279708 73/186 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.