DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and mep1a.2

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001122199.1 Gene:mep1a.2 / 565535 ZFINID:ZDB-GENE-041001-208 Length:689 Species:Danio rerio


Alignment Length:266 Identity:88/266 - (33%)
Similarity:141/266 - (53%) Gaps:24/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSGIIYVLLLQVVLNSGKPLPAGVYDPEEAGGFVEGDMMLTEEQQRNLEQG---APKARNGLI 62
            |.|..:.:|||..    ....|||...:..:||...|..:.:..:.||.|.:|   ....||.:|
Zfish     4 MWRISLFFVLLAL----KACALPAQYGEDADAGELREDILEINLDSQRELFEGDIAGDPRRNAII 64

  Fly    63 NTEKRW--PGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCY 125
            :.:.||  |   :.|.::|..|...|..|...::...|.:|:.|:....| ..|::.| |..||:
Zfish    65 DEKARWQFP---IPYILTDTLDLNAKGVILQALEMYRLKSCVDFKPYEGE-STYISFT-KLDGCW 124

  Fly   126 TAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEF 190
            :.||.....|.::     :||.|.....:.||.:|||||||:||.|.|||::.:.::.|:.|||.
Zfish   125 SFVGDLKTGQNVS-----IGERCDTKAIVEHELLHALGFYHEQSRSDRDDYVKIWWDQIIEGKEH 184

  Fly   191 NFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGE----DTIVPLDSSAVIGQRVGLSSKDIDKI 251
            ||.||.|..:||....|||:|.:||||.:|:.:.:    .|.:|..:: :||||:..|:.|::::
Zfish   185 NFNKYEDDFITDLNTPYDYESIMHYRPLSFNKDPDIPTITTTIPAFNN-IIGQRLDFSALDLERL 248

  Fly   252 NIMYKC 257
            |.||:|
Zfish   249 NRMYEC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 70/198 (35%)
ZnMc_astacin_like 70..255 CDD:239807 64/188 (34%)
mep1a.2NP_001122199.1 ZnMc 26..254 CDD:294052 79/238 (33%)
Astacin 68..256 CDD:279708 70/198 (35%)
MAM 259..423 CDD:214533
MAM 264..423 CDD:99706
MATH 423..579 CDD:295307
EGF 619..653 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.