DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and hce2l1

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_009302797.1 Gene:hce2l1 / 564183 ZFINID:ZDB-GENE-070912-147 Length:232 Species:Danio rerio


Alignment Length:229 Identity:79/229 - (34%)
Similarity:119/229 - (51%) Gaps:29/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMMLTEEQQRNLEQGAPKARNGL--INTEKRWPGNV-----VVYRISDDFDTAHKKAIQTGID 94
            |||::            :|.:|:.:  :....|||..|     |.|.:|..:|...:..|:||:.
Zfish    21 EGDIL------------SPGSRSAITCLGDSCRWPKAVDGFVYVPYIMSTLYDDMDRITIETGML 73

  Fly    95 TLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFM 159
            .:...||::|...|.:.. :|.:..:. ||::.:|..|..|.::|:    ..||...|...||.|
Zfish    74 DISSSTCVKFVPRTHQAN-FLNIQPRY-GCWSYLGMTGGSQTVSLQ----SPGCMWSGVASHELM 132

  Fly   160 HALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSING 224
            |||||.|:||.|.||.::::::|||:..:..||:||.   ..:....|||.|.:||...|||.:|
Zfish   133 HALGFVHEQSRSDRDRYVSILWENIIENQRHNFRKYE---TNNLNTAYDYSSVMHYGRYAFSEDG 194

  Fly   225 EDTIVPL-DSSAVIGQRVGLSSKDIDKINIMYKC 257
            ..||:|. |....||||.|.|..||.||||:|.|
Zfish   195 GPTIIPKPDPYIPIGQRDGPSILDIHKINILYNC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 74/198 (37%)
ZnMc_astacin_like 70..255 CDD:239807 69/190 (36%)
hce2l1XP_009302797.1 Astacin 41..229 CDD:279708 74/197 (38%)
ZnMc_hatching_enzyme 47..228 CDD:239810 69/189 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.