DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and bmp1b

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_005155463.1 Gene:bmp1b / 559877 ZFINID:ZDB-GENE-060818-2 Length:970 Species:Danio rerio


Alignment Length:276 Identity:83/276 - (30%)
Similarity:127/276 - (46%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPEEAGGFVEGDMMLTEEQQR-----------NLEQGAPK------------------------- 56
            ||.:|..|: ||:.|.||..|           |...|:.|                         
Zfish    36 DPCKAVAFL-GDIALDEEDLRFLKAHYMHATENESSGSSKPDSVNRSSANRNAKDEPVLANQSIL 99

  Fly    57 --ARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTA 119
              .|......|:.||..::.|.||.:|..:.:...:..:...|.|||:.|.|.:.|: :|:..|.
Zfish   100 RRRRAATARPERVWPNGIIPYIISGNFTGSQRAIFKQAMRHWEKHTCVTFVERSVEE-SYIVFTL 163

  Fly   120 KSGGCYTAVGYQ-GAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYEN 183
            :..||.:.||.: |.||.::     :|:.|.:.|.::||..|.:||:|:.:...||:.:::..||
Zfish   164 RPCGCCSFVGRRGGGPQAIS-----IGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVDIFREN 223

  Fly   184 IVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSING--EDTIVP-LDSSAV---IGQRVG 242
            |.||:|:||.|.....|......||:||.:||....|| .|  .||::| .|...|   ||||..
Zfish   224 IQPGQEYNFIKMEPDDVDSLGEVYDFDSIMHYARNTFS-RGIYLDTMLPKYDVDGVRPPIGQRTR 287

  Fly   243 LSSKDIDKINIMYKCP 258
            ||..||.:...:|:||
Zfish   288 LSKGDIAQARKLYRCP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 66/198 (33%)
ZnMc_astacin_like 70..255 CDD:239807 63/191 (33%)
bmp1bXP_005155463.1 ZnMc_BMP1_TLD 109..303 CDD:239808 67/200 (34%)
Astacin 111..303 CDD:279708 66/198 (33%)
CUB 305..414 CDD:278839
CUB 418..527 CDD:278839
EGF_CA 530..570 CDD:214542
CUB 575..684 CDD:278839
FXa_inhibition 691..726 CDD:291342
CUB 731..840 CDD:278839
CUB 844..957 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.