DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and cuzd1.2

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_021323075.1 Gene:cuzd1.2 / 555768 ZFINID:ZDB-GENE-131119-30 Length:718 Species:Danio rerio


Alignment Length:184 Identity:31/184 - (16%)
Similarity:59/184 - (32%) Gaps:67/184 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 CLRFREATDEDKAYLT--------------VTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRP 151
            |:.:..|....:.:||              :|...|   ::.||   ||        ||..||..
Zfish   355 CVWYLSAQQGQRIFLTFADVQLERCCDCDYITIHDG---SSTGY---PQ--------LGNVCFND 405

  Fly   152 GTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYR 216
            .|  |:..|:...|           :.|::.:...|....|:.:             :.|.|...
Zfish   406 TT--HQAFHSTSRY-----------LTVVFRSDFSGVSHGFKAH-------------FTSSLTAD 444

  Fly   217 PGAFSINGEDTIVPLDSSAVIGQRVGLSSKD-----------IDKINIMYKCPI 259
            .|....:.::.::.|..|.:  ..:|.|..|           |....::::.|:
Zfish   445 QGRVDCSSDNMVIVLRRSYL--NSLGFSGNDLYVDDRLCRPNISSTEVVFRFPL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 30/181 (17%)
ZnMc_astacin_like 70..255 CDD:239807 30/178 (17%)
cuzd1.2XP_021323075.1 CUB 21..127 CDD:238001
Somatomedin_B 131..164 CDD:307259
Somatomedin_B 175..214 CDD:321959
Somatomedin_B <239..260 CDD:307259
CUB 330..439 CDD:238001 21/123 (17%)
ZP 450..694 CDD:214579 7/49 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.