DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and mep1a.1

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001025452.1 Gene:mep1a.1 / 553530 ZFINID:ZDB-GENE-041001-209 Length:598 Species:Danio rerio


Alignment Length:272 Identity:92/272 - (33%)
Similarity:133/272 - (48%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IIYVLLLQVVLNSGKPLPAGVYDPEEAGGF------------VEGDMMLTEEQQRNLEQGAPKAR 58
            :|:.:|..|:  ...||.:.|::.|:...|            :|||:.|            |..|
Zfish     7 LIFAVLAAVL--HAVPLSSRVHEVEDEPNFNPFINLGAKTRLIEGDIAL------------PPGR 57

  Fly    59 NGLINTEKRW--PGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKS 121
            .|||||..||  |   :.|.:||..|...|.||....:...|.:|:.|:....| |.|:.. .|.
Zfish    58 IGLINTTYRWKFP---IPYILSDSLDLNAKGAIYQAFEVYRLKSCVDFKPYEGE-KTYIKF-EKG 117

  Fly   122 GGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVP 186
            .||::.||     .:.|.::..||.||.....|.||.:|||||||.||...|||::.:..:.::.
Zfish   118 DGCWSFVG-----DQQNGQVLSLGPGCDHKAVIEHELLHALGFYHMQSRQDRDDYVKIWLDQVIE 177

  Fly   187 GKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVPLDSS------AVIGQRVGLSS 245
            |.|.||.||.|:.|||....|||:|.:||||.||:   :|..:|..::      .:|||.:..|.
Zfish   178 GLEHNFNKYDDSFVTDLNTPYDYESVMHYRPFAFN---KDPSIPTITTNIPEFYKIIGQYLDFSE 239

  Fly   246 KDIDKINIMYKC 257
            .||.::|.||.|
Zfish   240 MDIVRLNRMYNC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 73/200 (37%)
ZnMc_astacin_like 70..255 CDD:239807 67/190 (35%)
mep1a.1NP_001025452.1 ZnMc 26..251 CDD:294052 85/249 (34%)
Astacin 65..253 CDD:279708 73/200 (37%)
MAM 261..420 CDD:279023
MAM 261..419 CDD:99706
MATH 419..582 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.