DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and tll2l

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001016661.1 Gene:tll2l / 549415 XenbaseID:XB-GENE-478930 Length:500 Species:Xenopus tropicalis


Alignment Length:285 Identity:78/285 - (27%)
Similarity:121/285 - (42%) Gaps:55/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YVLLLQVVLNSGKPLPA-----------GVYDPEEAGGF--------------VEGDMMLTEEQQ 47
            |:::..|...:..||..           ..:.|.:|..|              ::||:.:.    
 Frog     8 YIIICLVTYATSLPLTTLEKPLESDDHQETHKPNDADIFTQIIASNEGIDQLLLQGDIAIR---- 68

  Fly    48 RNLEQGAPKARNGLINTEKRWP----GNV-VVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREA 107
                    ..|:.|.....:|.    |.| |.:.:|..:..:....|...:...|..||:.|...
 Frog    69 --------VVRSSLQCDNCKWDISSNGKVPVPFTVSPGYTKSQLALITAAMQEFETLTCVDFVPK 125

  Fly   108 TDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSI 172
            |:| |..:.:. ...||::.:|..|..|:::|.    .:.|...|.|.||..|.|||.|:...|.
 Frog   126 TNE-KNVININ-NGNGCWSYIGRSGGVQQVSLS----KQSCMVKGIIQHELNHVLGFVHEHVRSD 184

  Fly   173 RDDFINVIYENIVPGKEFNFQKYADTVVT-DFEVGYDYDSCLHYRPGAFSING--EDTIVPLDSS 234
            ||.::||:.:||:|....||    |..|| :..:.|||.|.:||...||||:.  ...|...|.:
 Frog   185 RDQYVNVVKKNILPDSLGNF----DIAVTNNLGLPYDYYSVMHYPRNAFSISPFLPTLITKPDPT 245

  Fly   235 AVIGQRVGLSSKDIDKINIMYKCPI 259
            ..||||.||::.||.|||.:|.|.:
 Frog   246 IQIGQRYGLTNLDIAKINKLYNCDV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 66/199 (33%)
ZnMc_astacin_like 70..255 CDD:239807 64/188 (34%)
tll2lNP_001016661.1 ZnMc_hatching_enzyme 86..268 CDD:239810 65/191 (34%)
CUB 272..382 CDD:238001
CUB 385..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.