DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and mep1a

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001015767.1 Gene:mep1a / 548484 XenbaseID:XB-GENE-921661 Length:704 Species:Xenopus tropicalis


Alignment Length:281 Identity:89/281 - (31%)
Similarity:134/281 - (47%) Gaps:45/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSGI--------IYVLLLQVVLN----SGKPLPAGVYDPE------EAG-GFVEGDMMLTEEQ 46
            |.|.|:        :.|.|..:.:|    .|....||....:      |:| ...|||::|    
 Frog     1 MGRQGLFRLCCLLGLSVCLTAISINHRPKQGNEADAGELREDIPQINLESGLNLFEGDIVL---- 61

  Fly    47 QRNLEQGAPKARNGLINTEKRW--PGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATD 109
                   .|:|||.|::...||  |   :.|.::|:.|...|..|....:...|.:|:.|:....
 Frog    62 -------PPRARNALLDDYYRWSFP---IPYILADNLDLNAKSVILKAFEMFRLKSCVDFKPYEG 116

  Fly   110 EDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRD 174
            | ..|:.. .|.|||::.||.....|.::     :||.|.....:.||.:|||||||:||.|.||
 Frog   117 E-PTYIHF-QKFGGCWSMVGDLKVGQNLS-----IGERCDYKAIVEHEILHALGFYHEQSRSDRD 174

  Fly   175 DFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVPLDSSA---V 236
            |::.:.:|.|..|.|.||.||.|..:||....|||:|.:||.|.:|:.|.:...:.....|   :
 Frog   175 DYVKIWWEEITSGMEHNFNKYEDNYITDLNTPYDYESVMHYGPLSFNKNPDVPTITAKIEAFNDI 239

  Fly   237 IGQRVGLSSKDIDKINIMYKC 257
            ||||:..|..|::::|.||.|
 Frog   240 IGQRLDFSEIDLERLNRMYNC 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 69/197 (35%)
ZnMc_astacin_like 70..255 CDD:239807 63/187 (34%)
mep1aNP_001015767.1 ZnMc_meprin 31..260 CDD:239809 82/249 (33%)
MAM 270..431 CDD:366209
MATH_Meprin_Alpha 430..596 CDD:239752
EGF 635..>658 CDD:333761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4540
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.