DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and ASTL

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_011509507.1 Gene:ASTL / 431705 HGNCID:31704 Length:436 Species:Homo sapiens


Alignment Length:250 Identity:82/250 - (32%)
Similarity:124/250 - (49%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KPLPA---GVY--DPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWP--GNVVV--- 74
            |.:||   |:.  :..|:...:|||::            .|.....|..|..:||  |:.||   
Human    58 KDIPAINQGLILEETPESSFLIEGDII------------RPSPFRLLSATSNKWPMGGSGVVEVP 110

  Fly    75 YRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNL 139
            :.:|..:|...::.|...:...|..||:||  .|.:|:..........||:::||..|..|.::|
Human   111 FLLSSKYDEPSRQVILEALAEFERSTCIRF--VTYQDQRDFISIIPMYGCFSSVGRSGGMQVVSL 173

  Fly   140 EIYPLGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQK-YADTVVTDF 203
            ....|.:|   .|.:|||.||.|||:|:.:.:.||.:|.|.:..|:||.|.||.| .:..::|. 
Human   174 APTCLQKG---RGIVLHELMHVLGFWHEHTRADRDRYIRVNWNEILPGFEINFIKSQSSNMLTP- 234

  Fly   204 EVGYDYDSCLHYRPGAFSINGEDTIVPLDSSAV-IGQRVGLSSKDIDKINIMYKC 257
               |||.|.:||...|||..|..||.||.:.:| ||||..||:.||.::..:|.|
Human   235 ---YDYSSVMHYGRLAFSRRGLPTITPLWAPSVHIGQRWNLSASDITRVLKLYGC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 70/198 (35%)
ZnMc_astacin_like 70..255 CDD:239807 67/189 (35%)
ASTLXP_011509507.1 Astacin 97..288 CDD:279708 70/198 (35%)
ZnMc 105..286 CDD:294052 67/189 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm41174
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.