DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15255 and CG5715

DIOPT Version :9

Sequence 1:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster


Alignment Length:236 Identity:87/236 - (36%)
Similarity:129/236 - (54%) Gaps:12/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTG 92
            :|||.|.:.|||:::....:.....|   .|||::....||||.||.|.|...|.:.....|...
  Fly    68 NPEELGTYHEGDILIPLSYRDARFNG---TRNGILALSSRWPGGVVPYEIKGPFTSQELGNINHA 129

  Fly    93 IDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRP-GTILH 156
            .......||:||:..|.| |.|:::.:...||::::|..|..||:||:    ...|.|. ||.:|
  Fly   130 FKEYHTKTCVRFKPRTTE-KDYISIGSGKSGCWSSIGRLGGRQEVNLQ----SPNCLRTYGTPIH 189

  Fly   157 EFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFS 221
            |.||||||:|:|:...||.::.|:.:||.|....||:|.:......|.|.|||.|.:||.|.:|:
  Fly   190 ELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFT 254

  Fly   222 INGEDTIVPL---DSSAVIGQRVGLSSKDIDKINIMYKCPI 259
            .||:.|:..|   ..::.:|||.|.|:.|:.|||.||||.:
  Fly   255 RNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKCKV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 75/195 (38%)
ZnMc_astacin_like 70..255 CDD:239807 69/188 (37%)
CG5715NP_651242.1 Astacin 104..295 CDD:279708 76/195 (39%)
ZnMc_astacin_like 107..291 CDD:239807 69/188 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm44135
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
87.850

Return to query results.
Submit another query.